Escherichia coli Colicin-Ia (cia) (626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT) Recombinant Protein

SKU: BCACP-605541 Category:
Product SKUBCACP-605541
Product DescriptionEscherichia coli Colicin-Ia (cia) (626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT) Recombinant Protein is expressed from E.coli with C-terminal 6xHis-tagged. It contains 1-626aa(626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT). [Accession | P06716].
Uniprot No.P06716
Gene Namescia
Protein LengthFull Length
Purity≥ 95% as determined by SDS-PAGE.
Expression SystemE.coli
Expression Region1-626aa(626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT)
SpeciesEscherichia coli
Tag InfoC-terminal 6xHis-tagged
Molecular weight74.9 kDa
BufferLyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Protein FamiliesChannel forming colicin family

Escherichia coli Colicin-Ia (cia) (626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT) Recombinant Protein is expressed from E.coli with C-terminal 6xHis-tagged. It contains 1-626aa(626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT). [Accession | P06716].

SDS-PAGE: Single band at expected molecular weight confirming purity.

ELISA: Suitable as coating antigen or detection standard.

Western Blot: Compatible with standard Western Blot protocols.

Protein Interaction: Validated for SPR (Surface Plasmon Resonance) and BLI (Bio-Layer Interferometry) studies.

Shipping: Shipped at ambient temperature. Lyophilized protein is stable during transit.

Storage: Store lyophilized protein at -20°C to -80°C. Reconstituted protein should be aliquoted and stored at -80°C. Avoid repeated freeze-thaw cycles.

Shelf Life: 12 months from date of receipt when stored as recommended.

Shipping Time: Orders placed before 2 PM EST ship same day. International orders typically deliver within 5-10 business days.

Frequently Asked Questions

How do I order or inquire about this product?

Fill out the Online Inquiry form with your required quantity and specifications. You can also email sales@biocrestsci.com. Our team typically responds within 4 business hours with a quote and availability confirmation.

What is the shipping and delivery time?

Orders placed before 2 PM EST ship the same day. Domestic (US) delivery typically takes 2-3 business days. International orders deliver within 5-10 business days. All products are shipped at ambient temperature with appropriate packaging to ensure stability.

How should I store this recombinant protein?

Lyophilized proteins should be stored at -20°C to -80°C upon receipt. After reconstitution, aliquot and store at -80°C. Avoid repeated freeze-thaw cycles. Shelf life is 12 months from date of receipt when stored as recommended.

What quality controls are performed on your products?

Each product undergoes SDS-PAGE purity analysis (typically >85-95%), endotoxin testing, and bioactivity validation. Products are validated for ELISA, Western Blot, and SPR/BLI applications as specified on this product page. A Certificate of Analysis (CoA) is available upon request.

Shopping Cart
Scroll to Top