Escherichia coli Colicin-Ia (cia) (626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT) Recombinant Protein is expressed from E.coli with C-terminal 6xHis-tagged. It contains 1-626aa(626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT). [Accession | P06716].
Escherichia coli Colicin-Ia (cia) (626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT) Recombinant Protein
| Product SKU | BCACP-605541 |
| Product Description | Escherichia coli Colicin-Ia (cia) (626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT) Recombinant Protein is expressed from E.coli with C-terminal 6xHis-tagged. It contains 1-626aa(626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT). [Accession | P06716]. |
| Uniprot No. | P06716 |
| Gene Names | cia |
| Protein Length | Full Length |
| Purity | ≥ 95% as determined by SDS-PAGE. |
| Expression System | E.coli |
| Expression Region | 1-626aa(626:I→I-GYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLT) |
| Species | Escherichia coli |
| Tag Info | C-terminal 6xHis-tagged |
| Molecular weight | 74.9 kDa |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Protein Families | Channel forming colicin family |
SDS-PAGE: Single band at expected molecular weight confirming purity.
ELISA: Suitable as coating antigen or detection standard.
Western Blot: Compatible with standard Western Blot protocols.
Protein Interaction: Validated for SPR (Surface Plasmon Resonance) and BLI (Bio-Layer Interferometry) studies.
Shipping: Shipped at ambient temperature. Lyophilized protein is stable during transit.
Storage: Store lyophilized protein at -20°C to -80°C. Reconstituted protein should be aliquoted and stored at -80°C. Avoid repeated freeze-thaw cycles.
Shelf Life: 12 months from date of receipt when stored as recommended.
Shipping Time: Orders placed before 2 PM EST ship same day. International orders typically deliver within 5-10 business days.
Frequently Asked Questions
How do I order or inquire about this product?
Fill out the Online Inquiry form with your required quantity and specifications. You can also email sales@biocrestsci.com. Our team typically responds within 4 business hours with a quote and availability confirmation.
What is the shipping and delivery time?
Orders placed before 2 PM EST ship the same day. Domestic (US) delivery typically takes 2-3 business days. International orders deliver within 5-10 business days. All products are shipped at ambient temperature with appropriate packaging to ensure stability.
How should I store this recombinant protein?
Lyophilized proteins should be stored at -20°C to -80°C upon receipt. After reconstitution, aliquot and store at -80°C. Avoid repeated freeze-thaw cycles. Shelf life is 12 months from date of receipt when stored as recommended.
What quality controls are performed on your products?
Each product undergoes SDS-PAGE purity analysis (typically >85-95%), endotoxin testing, and bioactivity validation. Products are validated for ELISA, Western Blot, and SPR/BLI applications as specified on this product page. A Certificate of Analysis (CoA) is available upon request.
